PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG076800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 405aa    MW: 44188 Da    PI: 4.9058
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG076800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.48.2e-28958150
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                         krien++nrqvtfskRrng++KKA+ELSvLCd+++a+i+fs++++l  +s
  Pavir.4NG076800.1.p  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDIDIALIMFSPSNRLSHFS 58
                         79********************************************9997 PP

2K-box19.34.5e-08111179977
                K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqi 77 
                            +++ e+lq+e++k + +++ L++ +R +  + +   s++e +  e+ L + l ++ ++K+ ll++++
  Pavir.4NG076800.1.p 111 PVNSNIEELQHEIRKYQHQVQALEERLRMFEPDLVALASMNEVEATEKFLMETLARVEERKKFLLCNHM 179
                          567899********************8888888888889***********************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.422161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.35E-29281IPR002100Transcription factor, MADS-box
CDDcd002652.37E-36275No hitNo description
PRINTSPR004042.0E-25323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.8E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD IDIALIMFSP SNRLSHFSGR  60
RRIEDVITKY INLPEHDRGG VVRNREYLIK MLTQLKCESD IAEQLTPNKG PVNSNIEELQ  120
HEIRKYQHQV QALEERLRMF EPDLVALASM NEVEATEKFL METLARVEER KKFLLCNHMG  180
PFDPSPSEMQ HVFGLPAAPV AAPPQHEQPG DMGVNAFGVG GDVVSWFADA IPGAGPSIFA  240
GGPDPILAFR EQAIFDMQRD AGVDPGMAAM CHVDQHGGGG PSDDWQQAYT AAEFLSALIP  300
PTPCFPLDDQ VEAARDDELD KTSTTALQQP RFSVHDLELE AVMQDSMGGP VLAPPMVPPP  360
HAHEQVEASP GSCSNVPSPG GDTAAAAHQE QQQHGLPGGA VNIG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S8e-19175174Myocyte-specific enhancer factor 2B
1tqe_R8e-19175174Myocyte-specific enhancer factor 2B
1tqe_Q8e-19175174Myocyte-specific enhancer factor 2B
1tqe_P8e-19175174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660505.11e-169PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA0A096T9Z31e-163A0A096T9Z3_MAIZE; Uncharacterized protein
STRINGGRMZM2G334225_P011e-163(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49533360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.14e-71AGAMOUS-like 104